PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G069400.1.p
Common NameLOC101782452, SETIT_017608mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 360aa    MW: 39215.9 Da    PI: 8.6931
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G069400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333993155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Seita.1G069400.1.p 39 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 93
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-323694IPR009057Homeodomain-like
PROSITE profilePS5129412.3473696IPR017930Myb domain
SuperFamilySSF466891.63E-163894IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233994IPR006447Myb domain, plants
PfamPF002491.1E-74191IPR001005SANT/Myb domain
PfamPF143791.6E-25134181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MFSSKKATSA AAAAAAVSSN DRQMCVQGDS GLVLTTDPKP RLRWTVELHE RFVDAVTQLG  60
GPDKATPKTI MRVMGVKGLT LYHLKSHLQK FRLGKQPHKE FNDHSVKDAA AMEMQRNAAS  120
SSGMMGRSMN DRSVHMNEAI RMQMEVQRRL HEQLEVQKHL QMRIEAQGKY MQSILEKAYQ  180
TIASGDVAAC PAGGYKSLGN PAIVDVCSFK DIGPSMGFAS LQDLHMYGGG HLDLQHQMER  240
PMEAFFANCD MGSLGKKRLS PYAAGKSPMM WGDDEQGKGG IDHLQMAPPM MDAGGIDVMD  300
SIADVYGDVK PMMSSDSTGS KGCFEGKLER PSPRRPHMGN ERMGSPSVIG GQTRNLSYG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280520.0KJ728052.1 Zea mays clone pUT6198 G2-like transcription factor (GLK53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951748.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-100APL_ARATH; Myb family transcription factor APL
TrEMBLK3YTL20.0K3YTL2_SETIT; Uncharacterized protein
STRINGSi017608m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.28e-91G2-like family protein